PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT16145
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 454aa    MW: 49674.3 Da    PI: 8.6788
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT16145genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.57.3e-30129185259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               dDgynWrKYGqK vkg e+prsYY+Ct+a+Cpvkkkve+sa  +++++i+Y+g+Hnh+
  EMT16145 129 DDGYNWRKYGQKAVKGGEYPRSYYKCTQASCPVKKKVEHSA-YGQITQIIYRGQHNHQ 185
               8****************************************.9**************8 PP

2WRKY376.8e-12295317123
               ---SS-EEEEEEE--TT-SS-EE CS
      WRKY   1 ldDgynWrKYGqKevkgsefprs 23 
               ldDgy+WrKYGqK+vkg+++pr 
  EMT16145 295 LDDGYRWRKYGQKVVKGNPHPRM 317
               59********************6 PP

3WRKY59.37.6e-193523961559
               -TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY  15 vkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               vkg  + rsYY+Ct++gC vkk++er+++dp++v++tYeg+H h+
  EMT16145 352 VKGRGVGRSYYKCTYQGCDVKKHIERCSQDPTAVITTYEGKHSHD 396
               9999****************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.806.8E-27120187IPR003657WRKY domain
SuperFamilySSF1182907.98E-24126187IPR003657WRKY domain
SMARTSM007743.5E-30128186IPR003657WRKY domain
PfamPF031061.1E-22129185IPR003657WRKY domain
PROSITE profilePS5081122.814129187IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-34282315IPR003657WRKY domain
SuperFamilySSF1182902.35E-10287319IPR003657WRKY domain
PROSITE profilePS5081128.966290398IPR003657WRKY domain
SMARTSM007742.7E-33295397IPR003657WRKY domain
PfamPF031062.8E-8296319IPR003657WRKY domain
PfamPF031068.0E-13352396IPR003657WRKY domain
SuperFamilySSF1182904.58E-15352398IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-34359398IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009960Biological Processendosperm development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MSGACSSWLF FLLLPLLPRT LGLGPWVLRG LLSMNKGNFE MSHQQALAQV TAQAVHSQYT  60
VGSQADYSLP FSSATTSALT SQFINSSANV TSMKETATLP LHTVNDNLKS NEVSQGFQTS  120
ALTVDKPADD GYNWRKYGQK AVKGGEYPRS YYKCTQASCP VKKKVEHSAY GQITQIIYRG  180
QHNHQRPPKR RSKDGGNLLN EDDFPENRDT LTRSEPGSQD HSGKVEVSND GITGSSISKR  240
RDGGDQSSGS SDREEDNDEA GDDNGDAGIV NANKRHVPAP AQRIIVQTTS EIDLLDDGYR  300
WRKYGQKVVK GNPHPRMVFE KVDSSFQLKL ISFHPGHLDL SHLHTPCCIL VVKGRGVGRS  360
YYKCTYQGCD VKKHIERCSQ DPTAVITTYE GKHSHDVPAA RSSVAAAASA NASSSISLLH  420
RGQKAASSSQ RVLPRAALHT SDSSLQLKEE NEIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A4e-25114399578Probable WRKY transcription factor 4
1wj2_A4e-25114399578Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185190RPPKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8273950.0KR827395.1 Triticum aestivum WRKY44 transcriptional factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559732.10.0PREDICTED: probable WRKY transcription factor 4
RefseqXP_010233399.10.0PREDICTED: probable WRKY transcription factor 4
TrEMBLN1QX680.0N1QX68_AEGTA; Putative WRKY transcription factor 4
STRINGMLOC_31894.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.22e-66WRKY DNA-binding protein 4